PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00088.1_g00009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 267aa    MW: 30532.6 Da    PI: 5.9235
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00088.1_g00009.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.92.4e-131461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg+WT eEd +l + +   G ++W+ +++  g+ R++k+c++rw +yl
  Rsa1.0_00088.1_g00009.1 14 RGPWTIEEDHRLMNFILNNGIHCWRVVPKLAGLLRCGKSCRLRWINYL 61
                             89******************************99************97 PP

2Myb_DNA-binding54.92e-1767110146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              rg +T  E++++ +++ qlG++ W++Ia++++ gRt++++k++w++
  Rsa1.0_00088.1_g00009.1  67 RGGFTDAEEDRIMELHSQLGNR-WSKIASHFP-GRTDNEIKNHWNT 110
                              788*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-20564IPR009057Homeodomain-like
PROSITE profilePS5129412.95961IPR017930Myb domain
SuperFamilySSF466894.12E-2811108IPR009057Homeodomain-like
SMARTSM007176.4E-61363IPR001005SANT/Myb domain
PfamPF002491.3E-111461IPR001005SANT/Myb domain
CDDcd001672.31E-41661No hitNo description
PROSITE profilePS5129426.09662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.8E-2665117IPR009057Homeodomain-like
SMARTSM007174.4E-1566114IPR001005SANT/Myb domain
PfamPF002493.4E-1567110IPR001005SANT/Myb domain
CDDcd001672.75E-1070110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MGRKPCCEKI GLKRGPWTIE EDHRLMNFIL NNGIHCWRVV PKLAGLLRCG KSCRLRWINY  60
LRPDLKRGGF TDAEEDRIME LHSQLGNRWS KIASHFPGRT DNEIKNHWNT KIKKKMKHLG  120
LDQATHEPMN SIIDQTESKQ ITNPNMFSTS TVREETKDEP KDDIIAETSK TLIVTNNGKE  180
LQAENCKTLC AEEVDIGSLF AMQDNEISIS SSSFSSLYSN ISRSESSSYL AGDSVSLEQW  240
DLDMTDPLVP WDLFGNLDDT LFLYDKM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-28121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00510DAPTransfer from AT5G14340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196220.0AY519622.1 Arabidopsis thaliana MYB transcription factor (At5g14340) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013714155.11e-166PREDICTED: myb-related protein 315-like
RefseqXP_013674997.11e-166PREDICTED: myb-related protein 315
RefseqXP_013665981.11e-166PREDICTED: myb-related protein 315-like
TrEMBLA0A078C3J81e-166A0A078C3J8_BRANA; BnaA10g19370D protein
TrEMBLA0A078J2W11e-166A0A078J2W1_BRANA; BnaC09g54480D protein
STRINGBra008764.1-P1e-164(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.11e-143myb domain protein 40